SCOP 1.57: Domain d1jh8a_: 1jh8 A:

Lineage for d1jh8a_ (1jh8 A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)

4. Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (1 family)

5. Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (1 protein)

6. Protein Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52735] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [52736] (4 PDB entries)

8. Domain d1jh8a_: 1jh8 A: [63052]

Details for d1jh8a_

PDB Entry: 1jh8, 1.8 Å

PDB Description: Structural Investigation of the Biosynthesis of Alternative Lower Ligands for Cobamides by Nicotinate Mononucleotide:5,6-Dimethylbenzimidazole Phosphoribosyltransferase (CobT) from Salmonella enterica

SCOP Domain Sequences for d1jh8a_:

Sequence; same for both SEQRES and ATOM records:

>d1jh8a_ c.39.1.1 (A:) Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) {Salmonella typhimurium}
tlhallrdipapdaeamartqqhidgllkppgslgrletlavqlagmpglngtpqvgeka
vlvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepi
pgvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgelgmanttp
aaamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfd
lvgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialah
lsmepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlpe

Timeline for d1jh8a_:

• d1jh8a_ is new in SCOP 1.57
  
• d1jh8a_ appears in SCOP 1.59
  
• d1jh8a_ appears in the current release, SCOPe 2.08