Lineage for d1jh2f_ (1jh2 F:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165795Fold b.35: GroES-like [50128] (2 superfamilies)
  4. 165796Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 165797Family b.35.1.1: GroES [50130] (2 proteins)
  6. 165798Protein Chaperonin-10 (GroES) [50131] (3 species)
  7. 165815Species Mycobacterium tuberculosis [TaxId:1773] [63753] (2 PDB entries)
  8. 165821Domain d1jh2f_: 1jh2 F: [63043]

Details for d1jh2f_

PDB Entry: 1jh2 (more details), 2.8 Å

PDB Description: Crystal structure of tetradecameric Mycobacterium tuberculosis chaperonin 10 at 2.8A resolution.

SCOP Domain Sequences for d1jh2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jh2f_ b.35.1.1 (F:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis}
kvnikpledkilvqaneaetttasglvipdtakekpqegtvvavgpgrwdedgekripld
vaegdtviyskyggteikyngeeylilsardvlavvsk

SCOP Domain Coordinates for d1jh2f_:

Click to download the PDB-style file with coordinates for d1jh2f_.
(The format of our PDB-style files is described here.)

Timeline for d1jh2f_: