SCOPe 2.08: Domain d1jh0l_: 1jh0 L:

Lineage for d1jh0l_ (1jh0 L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
   Uniprot P02954

8. Domain d1jh0l_: 1jh0 L: [63036]
   Other proteins in same PDB: d1jh0h1, d1jh0h2, d1jh0m_
   complexed with bcl, bph, fe, spo, u10; mutant

Details for d1jh0l_

PDB Entry: 1jh0, 3.5 Å

PDB Description: photosynthetic reaction center mutant with glu l 205 replaced to leu

PDB Compounds: (L:) Photosynthetic reaction center L subunit

SCOPe Domain Sequences for d1jh0l_:

Sequence; same for both SEQRES and ATOM records:

>d1jh0l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgklmrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipggin

Timeline for d1jh0l_:

• d1jh0l_ first appeared in SCOP 1.57, called d1jh0l1
  
• d1jh0l_ appears in SCOPe 2.07