Lineage for d1jgzh1 (1jgz H:36-246)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316165Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1316166Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1316167Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1316168Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1316169Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
    Uniprot P11846
  8. 1316232Domain d1jgzh1: 1jgz H:36-246 [63030]
    Other proteins in same PDB: d1jgzh2, d1jgzl_, d1jgzm_
    complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgzh1

PDB Entry: 1jgz (more details), 2.7 Å

PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced with lys
PDB Compounds: (H:) Photosynthetic reaction center H subunit

SCOPe Domain Sequences for d1jgzh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgzh1 b.41.1.1 (H:36-246) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaap

SCOPe Domain Coordinates for d1jgzh1:

Click to download the PDB-style file with coordinates for d1jgzh1.
(The format of our PDB-style files is described here.)

Timeline for d1jgzh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jgzh2