SCOP 1.63: Domain d1jgym_: 1jgy M:

Lineage for d1jgym_ (1jgy M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (29 PDB entries)

8. Domain d1jgym_: 1jgy M: [63029]
   Other proteins in same PDB: d1jgyh1, d1jgyh2, d1jgyl_
   complexed with bcl, bph, cdl, fe, spo, u10; mutant

Details for d1jgym_

PDB Entry: 1jgy, 2.7 Å

PDB Description: photosynthetic reaction center mutant with tyr m 76 replaced with phe

SCOP Domain Sequences for d1jgym_:

Sequence; same for both SEQRES and ATOM records:

>d1jgym_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwfqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d1jgym_:

• d1jgym_ first appeared in SCOP 1.57, called d1jgym1
  
• d1jgym_ was called d1jgym1 in SCOP 1.61
  
• d1jgym_ appears in SCOP 1.65
  
• d1jgym_ appears in the current release, SCOPe 2.08