SCOP 1.63: Domain d1jgxl_: 1jgx L:

Lineage for d1jgxl_ (1jgx L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)

8. Domain d1jgxl_: 1jgx L: [63024]
   Other proteins in same PDB: d1jgxh1, d1jgxh2, d1jgxm_
   complexed with bcl, bph, fe, spo, u10; mutant

Details for d1jgxl_

PDB Entry: 1jgx, 3.01 Å

PDB Description: photosynthetic reaction center mutant with thr m 21 replaced with asp

SCOP Domain Sequences for d1jgxl_:

Sequence; same for both SEQRES and ATOM records:

>d1jgxl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1jgxl_:

• d1jgxl_ first appeared in SCOP 1.57, called d1jgxl1
  
• d1jgxl_ was called d1jgxl1 in SCOP 1.61
  
• d1jgxl_ appears in SCOP 1.65
  
• d1jgxl_ appears in the current release, SCOPe 2.08