| Class b: All beta proteins [48724] (119 folds) |
| Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family) ![]() |
| Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
| Protein Photosynthetic reaction centre [50348] (3 species) |
| Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries) |
| Domain d1jgxh1: 1jgx H:36-250 [63022] Other proteins in same PDB: d1jgxh2, d1jgxl_, d1jgxm_ complexed with bcl, bph, fe, spo, u10; mutant |
PDB Entry: 1jgx (more details), 3.01 Å
SCOP Domain Sequences for d1jgxh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgxh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d1jgxh1: