SCOP 1.57: Domain d1jgwl1: 1jgw L:

Lineage for d1jgwl1 (1jgw L:)

1. Root: SCOP 1.57

2. Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)

3. Fold f.2: Membrane all-alpha [56868] (1 superfamily)

4. Superfamily f.2.1: Membrane all-alpha [56869] (10 families)

5. Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)

6. Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [56881] (23 PDB entries)

8. Domain d1jgwl1: 1jgw L: [63020]
   Other proteins in same PDB: d1jgwh1

Details for d1jgwl1

PDB Entry: 1jgw, 2.8 Å

PDB Description: photosynthetic reaction center mutant with thr m 21 replaced with leu

SCOP Domain Sequences for d1jgwl1:

Sequence; same for both SEQRES and ATOM records:

>d1jgwl1 f.2.1.2 (L:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1jgwl1:

• d1jgwl1 is new in SCOP 1.57
  
• d1jgwl1 appears in SCOP 1.59
  
• d1jgwl1 appears in the current release, SCOPe 2.08, called d1jgwl_