SCOP 1.57: Domain d1jgwh1: 1jgw H:36-246

Lineage for d1jgwh1 (1jgw H:36-246)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (23 PDB entries)

8. Domain d1jgwh1: 1jgw H:36-246 [63018]
   Other proteins in same PDB: d1jgwh2, d1jgwl1, d1jgwm1

Details for d1jgwh1

PDB Entry: 1jgw, 2.8 Å

PDB Description: photosynthetic reaction center mutant with thr m 21 replaced with leu

SCOP Domain Sequences for d1jgwh1:

Sequence; same for both SEQRES and ATOM records:

>d1jgwh1 b.41.1.1 (H:36-246) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaap

Timeline for d1jgwh1:

• d1jgwh1 is new in SCOP 1.57
  
• d1jgwh1 appears in SCOP 1.59
  
• d1jgwh1 appears in the current release, SCOPe 2.08