Lineage for d1jgqu_ (1jgq U:)

  1. Root: SCOP 1.63
  2. 272796Class i: Low resolution protein structures [58117] (18 folds)
  3. 272797Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 272798Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 272799Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 272800Protein 70S ribosome functional complex [58121] (2 species)
  7. 272864Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 272945Domain d1jgqu_: 1jgq U: [63014]

Details for d1jgqu_

PDB Entry: 1jgq (more details), 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgqu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgqu_ i.1.1.1 (U:) 70S ribosome functional complex {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1jgqu_:

Click to download the PDB-style file with coordinates for d1jgqu_.
(The format of our PDB-style files is described here.)

Timeline for d1jgqu_: