Lineage for d1jgpl_ (1jgp L:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 346163Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 346322Domain d1jgpl_: 1jgp L: [62984]

Details for d1jgpl_

PDB Entry: 1jgp (more details), 7 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgp, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgpl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgpl_ i.1.1.1 (L:) 70S ribosome functional complex {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1jgpl_:

Click to download the PDB-style file with coordinates for d1jgpl_.
(The format of our PDB-style files is described here.)

Timeline for d1jgpl_: