Lineage for d1jgop_ (1jgo P:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526664Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 526806Domain d1jgop_: 1jgo P: [62967]

Details for d1jgop_

PDB Entry: 1jgo (more details), 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgop_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgop_ i.1.1.1 (P:) 70S ribosome functional complex {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d1jgop_:

Click to download the PDB-style file with coordinates for d1jgop_.
(The format of our PDB-style files is described here.)

Timeline for d1jgop_: