Lineage for d1jgol_ (1jgo L:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1970701Protein 70S ribosome functional complex [58121] (4 species)
  7. 1971258Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1971400Domain d1jgol_: 1jgo L: [62963]

Details for d1jgol_

PDB Entry: 1jgo (more details), 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (L:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1jgol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgol_ i.1.1.1 (L:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d1jgol_:

Click to download the PDB-style file with coordinates for d1jgol_.
(The format of our PDB-style files is described here.)

Timeline for d1jgol_: