SCOPe 2.04: Domain d1jgok_: 1jgo K:

Lineage for d1jgok_ (1jgo K:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)

8. Domain d1jgok_: 1jgo K: [62962]

Details for d1jgok_

PDB Entry: 1jgo, 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

PDB Compounds: (K:) 30S ribosomal protein S8

SCOPe Domain Sequences for d1jgok_:

Sequence; same for both SEQRES and ATOM records:

>d1jgok_ i.1.1.1 (K:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

Timeline for d1jgok_:

• d1jgok_ first appeared in SCOP 1.57
  
• d1jgok_ appears in SCOPe 2.03
  
• d1jgok_ appears in SCOPe 2.05
  
• d1jgok_ appears in the current release, SCOPe 2.08