Lineage for d1jgok_ (1jgo K:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 754252Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 754381Domain d1jgok_: 1jgo K: [62962]

Details for d1jgok_

PDB Entry: 1jgo (more details), 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (K:) 30S ribosomal protein S8

SCOP Domain Sequences for d1jgok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgok_ i.1.1.1 (K:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1jgok_:

Click to download the PDB-style file with coordinates for d1jgok_.
(The format of our PDB-style files is described here.)

Timeline for d1jgok_: