Lineage for d1jgog_ (1jgo G:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432186Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 432187Protein 70S ribosome functional complex [58121] (2 species)
  7. 432472Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 432605Domain d1jgog_: 1jgo G: [62958]

Details for d1jgog_

PDB Entry: 1jgo (more details), 5.6 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgo, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgog_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgog_ i.1.1.1 (G:) 70S ribosome functional complex {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr

SCOP Domain Coordinates for d1jgog_:

Click to download the PDB-style file with coordinates for d1jgog_.
(The format of our PDB-style files is described here.)

Timeline for d1jgog_: