Lineage for d1jgmb_ (1jgm B:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (4 families) 
Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins) Protein Phosphotriesterase [51565] (1 species) Species Pseudomonas diminuta [TaxId:293] [51566] (9 PDB entries) 
Domain d1jgmb_: 1jgm B: [62954]
Details for d1jgmb_
PDB Entry: 1jgm (more details), 1.3 Å
PDB Description: High Resolution Structure of the Cadmium-containing Phosphotriesterase from Pseudomonas diminuta
SCOP Domain Sequences for d1jgmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgmb_ c.1.9.3 (B:) Phosphotriesterase {Pseudomonas diminuta}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallg
irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvi
pflrekgvpqetlagitvtnparflsptlras
SCOP Domain Coordinates for d1jgmb_:
Click to download the PDB-style file with coordinates for d1jgmb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jgmb_:
- d1jgmb_ is new in SCOP 1.57
- d1jgmb_ appears in SCOP 1.59
- d1jgmb_ appears in the current release, SCOPe 2.08
View in 3D
