Lineage for d1jgma_ (1jgm A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65203Superfamily c.1.9: Metallo-dependent hydrolases [51556] (4 families) (S)
  5. 65255Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins)
  6. 65256Protein Phosphotriesterase [51565] (1 species)
  7. 65257Species Pseudomonas diminuta [TaxId:293] [51566] (9 PDB entries)
  8. 65260Domain d1jgma_: 1jgm A: [62953]

Details for d1jgma_

PDB Entry: 1jgm (more details), 1.3 Å

PDB Description: High Resolution Structure of the Cadmium-containing Phosphotriesterase from Pseudomonas diminuta

SCOP Domain Sequences for d1jgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgma_ c.1.9.3 (A:) Phosphotriesterase {Pseudomonas diminuta}
tgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
agvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflr
eiqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqq
aaifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasall
girswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrv
ipflrekgvpqetlagitvtnparflsptlras

SCOP Domain Coordinates for d1jgma_:

Click to download the PDB-style file with coordinates for d1jgma_.
(The format of our PDB-style files is described here.)

Timeline for d1jgma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jgmb_