Lineage for d1jg8c_ (1jg8 C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125751Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 125752Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 125753Family c.67.1.1: AAT-like [53384] (6 proteins)
  6. 125931Protein Low-specificity threonine aldolase [64123] (1 species)
  7. 125932Species Thermatoga maritima [64124] (1 PDB entry)
  8. 125935Domain d1jg8c_: 1jg8 C: [62948]

Details for d1jg8c_

PDB Entry: 1jg8 (more details), 1.8 Å

PDB Description: crystal structure of threonine aldolase (low-specificity)

SCOP Domain Sequences for d1jg8c_:

Sequence, based on SEQRES records: (download)

>d1jg8c_ c.67.1.1 (C:) Low-specificity threonine aldolase {Thermatoga maritima}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

Sequence, based on observed residues (ATOM records): (download)

>d1jg8c_ c.67.1.1 (C:) Low-specificity threonine aldolase {Thermatoga maritima}
midlrsdtvtkpteemrkamevgddvygedptinelerlaaetfgkeaalfvpsgtmgnq
vsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkairprn
ihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasgvpv
keyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaagiia
ltkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfiealrns
gvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOP Domain Coordinates for d1jg8c_:

Click to download the PDB-style file with coordinates for d1jg8c_.
(The format of our PDB-style files is described here.)

Timeline for d1jg8c_: