SCOP 1.73: Domain d1jg8b_: 1jg8 B:

Lineage for d1jg8b_ (1jg8 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.1: AAT-like [53384] (16 proteins)

6. Protein Low-specificity threonine aldolase [64123] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)

8. Domain d1jg8b_: 1jg8 B: [62947]

Details for d1jg8b_

PDB Entry: 1jg8, 1.8 Å

PDB Description: crystal structure of threonine aldolase (low-specificity)

PDB Compounds: (B:) L-allo-threonine aldolase

SCOP Domain Sequences for d1jg8b_:

Sequence; same for both SEQRES and ATOM records:

>d1jg8b_ c.67.1.1 (B:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

Timeline for d1jg8b_:

• d1jg8b_ first appeared in SCOP 1.57
  
• d1jg8b_ appears in SCOP 1.71
  
• d1jg8b_ appears in SCOP 1.75
  
• d1jg8b_ appears in the current release, SCOPe 2.08