Lineage for d1jg8a_ (1jg8 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147073Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2147378Protein Low-specificity threonine aldolase [64123] (2 species)
  7. 2147382Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)
  8. 2147387Domain d1jg8a_: 1jg8 A: [62946]
    Other proteins in same PDB: d1jg8d2
    complexed with ca, na

Details for d1jg8a_

PDB Entry: 1jg8 (more details), 1.8 Å

PDB Description: crystal structure of threonine aldolase (low-specificity)
PDB Compounds: (A:) L-allo-threonine aldolase

SCOPe Domain Sequences for d1jg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jg8a_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOPe Domain Coordinates for d1jg8a_:

Click to download the PDB-style file with coordinates for d1jg8a_.
(The format of our PDB-style files is described here.)

Timeline for d1jg8a_: