Lineage for d1jfic2 (1jfi C:457-538)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 510906Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 510907Family d.129.1.1: TATA-box binding protein (TBP), C-terminal domain [55946] (1 protein)
    duplication: consists of two clear structural repeats
  6. 510908Protein TATA-box binding protein (TBP), C-terminal domain [55947] (5 species)
    structure of the N-terminal domain is not known yet
  7. 510997Species Human (Homo sapiens) [TaxId:9606] [55948] (5 PDB entries)
  8. 511003Domain d1jfic2: 1jfi C:457-538 [62939]
    Other proteins in same PDB: d1jfia_, d1jfib_

Details for d1jfic2

PDB Entry: 1jfi (more details), 2.62 Å

PDB Description: crystal structure of the nc2-tbp-dna ternary complex

SCOP Domain Sequences for d1jfic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfic2 d.129.1.1 (C:457-538) TATA-box binding protein (TBP), C-terminal domain {Human (Homo sapiens)}
nmvgscdvkfpirleglvlthqqfssyepelfpgliyrmikprivllifvsgkvvltgak
vraeiyeafeniypilkgfrkt

SCOP Domain Coordinates for d1jfic2:

Click to download the PDB-style file with coordinates for d1jfic2.
(The format of our PDB-style files is described here.)

Timeline for d1jfic2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jfic1