|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones | 
|  | Superfamily a.22.1: Histone-fold [47113] (5 families)  | 
|  | Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) | 
|  | Protein Negative cofactor 2, NC2, beta chain [63509] (1 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [63510] (1 PDB entry) | 
|  | Domain d1jfib_: 1jfi B: [62937] Other proteins in same PDB: d1jfia_, d1jfic1, d1jfic2 protein/DNA complex | 
PDB Entry: 1jfi (more details), 2.62 Å
SCOPe Domain Sequences for d1jfib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]}
ddltipraainkmiketlpnvrvandarelvvncctefihlisseaneicnksekktisp
ehviqaleslgfgsyisevkevlqecktvalkrrkassrlenlgipeeellrqqqelfak
arqqqaelaqqewlq
Timeline for d1jfib_: