Lineage for d1jfia_ (1jfi A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2312488Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2312512Protein Negative cofactor 2, NC2, alpha chain [63507] (1 species)
  7. 2312513Species Human (Homo sapiens) [TaxId:9606] [63508] (1 PDB entry)
  8. 2312514Domain d1jfia_: 1jfi A: [62936]
    Other proteins in same PDB: d1jfib_, d1jfic1, d1jfic2, d1jfic3
    protein/DNA complex

Details for d1jfia_

PDB Entry: 1jfi (more details), 2.62 Å

PDB Description: crystal structure of the nc2-tbp-dna ternary complex
PDB Compounds: (A:) Transcription Regulator NC2 alpha chain

SCOPe Domain Sequences for d1jfia_:

Sequence, based on SEQRES records: (download)

>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]}
arfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrnaktmttsh
lkqcie

Sequence, based on observed residues (ATOM records): (download)

>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]}
arfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrtmttshlkq
cie

SCOPe Domain Coordinates for d1jfia_:

Click to download the PDB-style file with coordinates for d1jfia_.
(The format of our PDB-style files is described here.)

Timeline for d1jfia_: