Lineage for d1jfia_ (1jfi A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353304Family a.22.1.3: TBP-associated factors, TAFs [47134] (11 proteins)
  6. 353316Protein Negative cofactor 2, NC2, alpha chain [63507] (1 species)
  7. 353317Species Human (Homo sapiens) [TaxId:9606] [63508] (1 PDB entry)
  8. 353318Domain d1jfia_: 1jfi A: [62936]
    Other proteins in same PDB: d1jfib_, d1jfic1, d1jfic2

Details for d1jfia_

PDB Entry: 1jfi (more details), 2.62 Å

PDB Description: crystal structure of the nc2-tbp-dna ternary complex

SCOP Domain Sequences for d1jfia_:

Sequence, based on SEQRES records: (download)

>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens)}
arfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrnaktmttsh
lkqcie

Sequence, based on observed residues (ATOM records): (download)

>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens)}
arfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrtmttshlkq
cie

SCOP Domain Coordinates for d1jfia_:

Click to download the PDB-style file with coordinates for d1jfia_.
(The format of our PDB-style files is described here.)

Timeline for d1jfia_: