SCOP 1.69: Domain d1jffb2: 1jff B:246-437

Lineage for d1jffb2 (1jff B:246-437)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Tubulin beta-subunit [55313] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64322] (4 PDB entries)

8. Domain d1jffb2: 1jff B:246-437 [62935]
   Other proteins in same PDB: d1jffa1, d1jffa2, d1jffb1

Details for d1jffb2

PDB Entry: 1jff, 3.5 Å

PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol

SCOP Domain Sequences for d1jffb2:

Sequence; same for both SEQRES and ATOM records:

>d1jffb2 d.79.2.1 (B:246-437) Tubulin beta-subunit {Cow (Bos taurus)}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaac
dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqd

Timeline for d1jffb2:

• d1jffb2 first appeared in SCOP 1.57
  
• d1jffb2 appears in SCOP 1.67
  
• d1jffb2 appears in SCOP 1.71
  
• d1jffb2 appears in the current release, SCOPe 2.08