SCOPe 2.07: Domain d1jffa2: 1jff A:246-439

Lineage for d1jffa2 (1jff A:246-439)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Tubulin alpha-subunit [55311] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries)
   Uniprot P02550

8. Domain d1jffa2: 1jff A:246-439 [62933]
   Other proteins in same PDB: d1jffa1, d1jffb1, d1jffb2
   complexed with gdp, gtp, mg, ta1, zn

Details for d1jffa2

PDB Entry: 1jff, 3.5 Å

PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol

PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d1jffa2:

Sequence; same for both SEQRES and ATOM records:

>d1jffa2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

Timeline for d1jffa2:

• d1jffa2 first appeared in SCOP 1.57
  
• d1jffa2 appears in SCOPe 2.06
  
• d1jffa2 appears in the current release, SCOPe 2.08