Lineage for d1jffa2 (1jff A:246-439)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134814Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 134879Superfamily d.79.2: Tubulin, C-terminal domain [55307] (1 family) (S)
  5. 134880Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)
  6. 134884Protein Tubulin alpha-subunit [55311] (2 species)
  7. 134885Species Cow (Bos taurus) [TaxId:9913] [64321] (1 PDB entry)
  8. 134886Domain d1jffa2: 1jff A:246-439 [62933]
    Other proteins in same PDB: d1jffa1, d1jffb1, d1jffb2

Details for d1jffa2

PDB Entry: 1jff (more details), 3.5 Å

PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol

SCOP Domain Sequences for d1jffa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jffa2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Cow (Bos taurus)}
galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOP Domain Coordinates for d1jffa2:

Click to download the PDB-style file with coordinates for d1jffa2.
(The format of our PDB-style files is described here.)

Timeline for d1jffa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jffa1