SCOP 1.57: Domain d1jffa2: 1jff A:246-439

Lineage for d1jffa2 (1jff A:246-439)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (4 superfamilies)

4. Superfamily d.79.2: Tubulin, C-terminal domain [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Tubulin alpha-subunit [55311] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64321] (1 PDB entry)

8. Domain d1jffa2: 1jff A:246-439 [62933]
   Other proteins in same PDB: d1jffa1, d1jffb1, d1jffb2

Details for d1jffa2

PDB Entry: 1jff, 3.5 Å

PDB Description: refined structure of alpha-beta tubulin from zinc-induced sheets stabilized with taxol

SCOP Domain Sequences for d1jffa2:

Sequence; same for both SEQRES and ATOM records:

>d1jffa2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Cow (Bos taurus)}
galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

Timeline for d1jffa2:

• d1jffa2 is new in SCOP 1.57
  
• d1jffa2 appears in SCOP 1.59
  
• d1jffa2 appears in the current release, SCOPe 2.08