SCOPe 2.05: Domain d1jf2a_: 1jf2 A:

Lineage for d1jf2a_ (1jf2 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium-regulated photoprotein [47512] (4 species)
   structurally most similar to sarcoplasmic calcium-binding protein

7. Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (8 PDB entries)
   Uniprot Q27709

8. Domain d1jf2a_: 1jf2 A: [62930]
   complexed with czh; mutant

Details for d1jf2a_

PDB Entry: 1jf2, 1.72 Å

PDB Description: crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution

PDB Compounds: (A:) obelin

SCOPe Domain Sequences for d1jf2a_:

Sequence; same for both SEQRES and ATOM records:

>d1jf2a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}
avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq
vcveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkd
gsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe
adglygngvp

Timeline for d1jf2a_:

• d1jf2a_ first appeared in SCOP 1.57
  
• d1jf2a_ appears in SCOPe 2.04
  
• d1jf2a_ appears in SCOPe 2.06
  
• d1jf2a_ appears in the current release, SCOPe 2.08