Lineage for d1jf2a_ (1jf2 A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213324Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
    Duplication: made with two pairs of EF-hands
  6. 213343Protein Calcium-regulated photoprotein [47512] (3 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 213346Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (2 PDB entries)
  8. 213348Domain d1jf2a_: 1jf2 A: [62930]
    complexed with czh; mutant

Details for d1jf2a_

PDB Entry: 1jf2 (more details), 1.72 Å

PDB Description: crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution

SCOP Domain Sequences for d1jf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf2a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin}
avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq
vcveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkd
gsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe
adglygngvp

SCOP Domain Coordinates for d1jf2a_:

Click to download the PDB-style file with coordinates for d1jf2a_.
(The format of our PDB-style files is described here.)

Timeline for d1jf2a_: