Class a: All alpha proteins [46456] (171 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (9 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (17 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcium-regulated photoprotein [47512] (3 species) structurally most similar to sarcoplasmic calcium-binding protein |
Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (2 PDB entries) |
Domain d1jf2a_: 1jf2 A: [62930] complexed with czh; mutant |
PDB Entry: 1jf2 (more details), 1.72 Å
SCOP Domain Sequences for d1jf2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf2a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin} avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq vcveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkd gsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe adglygngvp
Timeline for d1jf2a_: