Lineage for d1jf2a_ (1jf2 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152578Family a.39.1.5: Calmodulin-like [47502] (16 proteins)
  6. 152594Protein Calcium-regulated photoprotein [47512] (3 species)
  7. 152597Species Hydrozoa (Obelia longissima), obelin [TaxId:32570] [63541] (2 PDB entries)
  8. 152599Domain d1jf2a_: 1jf2 A: [62930]

Details for d1jf2a_

PDB Entry: 1jf2 (more details), 1.72 Å

PDB Description: crystal structure of w92f obelin mutant from obelia longissima at 1.72 angstrom resolution

SCOP Domain Sequences for d1jf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf2a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin}
avklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhq
vcveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkd
gsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpe
adglygngvp

SCOP Domain Coordinates for d1jf2a_:

Click to download the PDB-style file with coordinates for d1jf2a_.
(The format of our PDB-style files is described here.)

Timeline for d1jf2a_: