Lineage for d1jf1a1 (1jf1 A:182-275)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654570Domain d1jf1a1: 1jf1 A:182-275 [62927]
    Other proteins in same PDB: d1jf1a2, d1jf1b_
    complexed with zn; mutant

Details for d1jf1a1

PDB Entry: 1jf1 (more details), 1.85 Å

PDB Description: Crystal structure of HLA-A2*0201 in complex with a decameric altered peptide ligand from the MART-1/Melan-A
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d1jf1a1:

Sequence, based on SEQRES records: (download)

>d1jf1a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records): (download)

>d1jf1a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqttelvetrpagdgtfqk
waavvvpsgqeqrytchvqheglpkpltlrwe

SCOP Domain Coordinates for d1jf1a1:

Click to download the PDB-style file with coordinates for d1jf1a1.
(The format of our PDB-style files is described here.)

Timeline for d1jf1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jf1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jf1b_