SCOP 1.57: Domain d1jf1a1: 1jf1 A:182-275

Lineage for d1jf1a1 (1jf1 A:182-275)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [48948] (24 PDB entries)

8. Domain d1jf1a1: 1jf1 A:182-275 [62927]
   Other proteins in same PDB: d1jf1a2

Details for d1jf1a1

PDB Entry: 1jf1, 1.85 Å

PDB Description: Crystal structure of HLA-A2*0201 in complex with a decameric altered peptide ligand from the MART-1/Melan-A

SCOP Domain Sequences for d1jf1a1:

Sequence, based on SEQRES records:

>d1jf1a1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records):

>d1jf1a1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-A2.1}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqttelvetrpagdgtfqk
waavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1jf1a1:

• d1jf1a1 is new in SCOP 1.57
  
• d1jf1a1 appears in SCOP 1.59
  
• d1jf1a1 appears in the current release, SCOPe 2.08