| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein Calcium-regulated photoprotein [47512] (4 species) structurally most similar to sarcoplasmic calcium-binding protein |
| Species Hydrozoa (Obelia geniculata), obelin [TaxId:185004] [63542] (1 PDB entry) |
| Domain d1jf0a_: 1jf0 A: [62926] complexed with czh has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1jf0 (more details), 1.82 Å
SCOPe Domain Sequences for d1jf0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia geniculata), obelin [TaxId: 185004]}
kyavklqtdfdnpkwikrhkfmfdyldingngqitldeivskasddicknlgatpaqtqr
hqdcveaffrgcgleygketkfpeflegwknlanadlakwarneptlirewgdavfdifd
kdgsgtitldewkaygrisgispseedcektfqhcdldnsgeldvdemtrqhlgfwytld
peadglygngvp
Timeline for d1jf0a_: