Lineage for d1jek.1 (1jek A:,B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2646635Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 2646636Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 2646682Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 2646761Species Visna virus [TaxId:11741] [64597] (1 PDB entry)
  8. 2646762Domain d1jek.1: 1jek A:,B: [62920]

Details for d1jek.1

PDB Entry: 1jek (more details), 1.5 Å

PDB Description: visna tm core structure
PDB Compounds: (A:) env polyprotein, (B:) env polyprotein

SCOPe Domain Sequences for d1jek.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1jek.1 h.3.2.1 (A:,B:) Retrovius gp41 protease-resistant core {Visna virus [TaxId: 11741]}
qslanataaqqevleasyamvqhiakgirilearvarveaXwqqweeeieqhegnlslll
reaalqvhiaqrdar

SCOPe Domain Coordinates for d1jek.1:

Click to download the PDB-style file with coordinates for d1jek.1.
(The format of our PDB-style files is described here.)

Timeline for d1jek.1: