![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
![]() | Family h.3.2.1: Virus ectodomain [58070] (9 proteins) |
![]() | Protein Retrovius gp41 protease-resistant core [58071] (4 species) coiled coil; biological unit: trimer |
![]() | Species Visna virus [TaxId:11741] [64597] (1 PDB entry) |
![]() | Domain d1jek.1: 1jek A:,B: [62920] |
PDB Entry: 1jek (more details), 1.5 Å
SCOPe Domain Sequences for d1jek.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1jek.1 h.3.2.1 (A:,B:) Retrovius gp41 protease-resistant core {Visna virus [TaxId: 11741]} qslanataaqqevleasyamvqhiakgirilearvarveaXwqqweeeieqhegnlslll reaalqvhiaqrdar
Timeline for d1jek.1: