Lineage for d1jehb3 (1jeh B:356-478)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135463Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
  4. 135464Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
  5. 135465Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins)
  6. 135466Protein Dihydrolipoamide dehydrogenase [55436] (7 species)
  7. 135473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64331] (1 PDB entry)
  8. 135475Domain d1jehb3: 1jeh B:356-478 [62917]
    Other proteins in same PDB: d1jeha1, d1jeha2, d1jehb1, d1jehb2

Details for d1jehb3

PDB Entry: 1jeh (more details), 2.4 Å

PDB Description: crystal structure of yeast e3, lipoamide dehydrogenase

SCOP Domain Sequences for d1jehb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jehb3 d.87.1.1 (B:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)}
ynnipsvmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilids
kterilgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydka
ihc

SCOP Domain Coordinates for d1jehb3:

Click to download the PDB-style file with coordinates for d1jehb3.
(The format of our PDB-style files is described here.)

Timeline for d1jehb3: