Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins) |
Protein Dihydrolipoamide dehydrogenase [55436] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64331] (1 PDB entry) |
Domain d1jehb3: 1jeh B:356-478 [62917] Other proteins in same PDB: d1jeha1, d1jeha2, d1jehb1, d1jehb2 |
PDB Entry: 1jeh (more details), 2.4 Å
SCOP Domain Sequences for d1jehb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jehb3 d.87.1.1 (B:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)} ynnipsvmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilids kterilgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydka ihc
Timeline for d1jehb3: