Lineage for d1jehb2 (1jeh B:161-282)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119214Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 119225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63950] (1 PDB entry)
  8. 119229Domain d1jehb2: 1jeh B:161-282 [62916]
    Other proteins in same PDB: d1jeha3, d1jehb3

Details for d1jehb2

PDB Entry: 1jeh (more details), 2.4 Å

PDB Description: crystal structure of yeast e3, lipoamide dehydrogenase

SCOP Domain Sequences for d1jehb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jehb2 c.3.1.5 (B:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)}
pgieideekivsstgalslkeipkrltiigggiiglemgsvysrlgskvtvvefqpqiga
smdgevakatqkflkkqgldfklstkvisakrnddknvveivvedtktnkqenleaevll
va

SCOP Domain Coordinates for d1jehb2:

Click to download the PDB-style file with coordinates for d1jehb2.
(The format of our PDB-style files is described here.)

Timeline for d1jehb2: