Lineage for d1jeha3 (1jeh A:356-478)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569463Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2569464Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2569472Protein Dihydrolipoamide dehydrogenase [55436] (8 species)
  7. 2569479Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64331] (2 PDB entries)
  8. 2569482Domain d1jeha3: 1jeh A:356-478 [62914]
    Other proteins in same PDB: d1jeha1, d1jeha2, d1jehb1, d1jehb2
    complexed with fad

Details for d1jeha3

PDB Entry: 1jeh (more details), 2.4 Å

PDB Description: crystal structure of yeast e3, lipoamide dehydrogenase
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1jeha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeha3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ynnipsvmyshpevawvgkteeqlkeagidykigkfpfaansraktnqdtegfvkilids
kterilgahiigpnagemiaeaglaleygasaedvarvchahptlseafkeanmaaydka
ihc

SCOPe Domain Coordinates for d1jeha3:

Click to download the PDB-style file with coordinates for d1jeha3.
(The format of our PDB-style files is described here.)

Timeline for d1jeha3: