SCOPe 2.06: Domain d1je5a_: 1je5 A:

Lineage for d1je5a_ (1je5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.7: Phage ssDNA-binding proteins [50315] (4 proteins)
   barrel, open; n*=5, S*=8; the members' structures vary greater that those from cellular organisms

6. Protein gp2.5 [63774] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [63775] (1 PDB entry)

8. Domain d1je5a_: 1je5 A: [62909]
   complexed with ca

Details for d1je5a_

PDB Entry: 1je5, 1.9 Å

PDB Description: Crystal Structure of gp2.5, a Single-Stranded DNA Binding Protein Encoded by Bacteriophage T7

PDB Compounds: (A:) helix-destabilizing protein

SCOPe Domain Sequences for d1je5a_:

Sequence, based on SEQRES records:

>d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]}
makkiftsalgtaepyayiakpdygneergfgnprgvykvdltipnkdprcqrmvdeivk
cheeayaaaveeyeanppavargkkplkpyegdmpffdngdgtttfkfkcyasfqdkktk
etkhinlvvvdskgkkmedvpiigggsklkvkyslvpykwntavgasvklqlesvmlvel
atfgggeddwadeveen

Sequence, based on observed residues (ATOM records):

>d1je5a_ b.40.4.7 (A:) gp2.5 {Bacteriophage T7 [TaxId: 10760]}
makkiftsalgtaepyayiakpdygngfgnprgvykvdltipnkdprcqrmvdeivkche
eayaaaveeyeanppplkpyegdmpffdngdgtttfkfkcyasfqdkktketkhinlvvv
dskgkkmedvpiigggsklkvkyslvpykwntavgasvklqlesvmlvelatdwadevee
n

Timeline for d1je5a_:

• d1je5a_ first appeared in SCOP 1.57
  
• d1je5a_ appears in SCOPe 2.05
  
• d1je5a_ appears in SCOPe 2.07
  
• d1je5a_ appears in the current release, SCOPe 2.08