Lineage for d1jdra_ (1jdr A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49663Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 49664Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 49665Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 49672Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 49673Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (71 PDB entries)
  8. 49674Domain d1jdra_: 1jdr A: [62908]

Details for d1jdra_

PDB Entry: 1jdr (more details), 1.5 Å

PDB Description: Crystal Structure of a Proximal Domain Potassium Binding Variant of Cytochrome c Peroxidase

SCOP Domain Sequences for d1jdra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdra_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
hlknsgyegpwtannnvfdnsfylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1jdra_:

Click to download the PDB-style file with coordinates for d1jdra_.
(The format of our PDB-style files is described here.)

Timeline for d1jdra_: