Lineage for d1jdpb_ (1jdp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143799Protein Hormone binding domain of the atrial natriuretic peptide receptor [53845] (2 species)
  7. 2143800Species Human (Homo sapiens) [TaxId:9606] [64190] (2 PDB entries)
  8. 2143802Domain d1jdpb_: 1jdp B: [62907]
    complexed with a C-type natriuretic peptide, chain H
    complexed with cl, nag, ndg

Details for d1jdpb_

PDB Entry: 1jdp (more details), 2 Å

PDB Description: Crystal Structure of Hormone/Receptor Complex
PDB Compounds: (B:) atrial natriuretic peptide clearance receptor

SCOPe Domain Sequences for d1jdpb_:

Sequence, based on SEQRES records: (download)

>d1jdpb_ c.93.1.1 (B:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]}
alppqkievlvllpqddsylfsltrvrpaieyalrsvegngtgrrllppgtrfqvayeds
dcgnralfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqh
kdseyshltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqe
eglhtsiysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaf
fnielfnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekq
glnmedyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsi
dangdrygdfsviamtdveagtqevigdyfgkegrfemrp

Sequence, based on observed residues (ATOM records): (download)

>d1jdpb_ c.93.1.1 (B:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]}
alppqkievlvllpqddsylfsltrvrpaieyalrsvegrllppgtrfqvayedsdcgnr
alfslvdrvaaargakpdlilgpvceyaaapvarlashwdlpmlsagalaagfqhkdsey
shltrvapayakmgemmlalfrhhhwsraalvysddklerncyftlegvhevfqeeglht
siysfdetkdldledivrniqaservvimcassdtirsimlvahrhgmtsgdyaffniel
fnsssygdgswkrgdkhdfeakqaysslqtvtllrtvkpefekfsmevkssvekqglnme
dyvnmfvegfhdaillyvlalhevlragyskkdggkiiqqtwnrtfegiagqvsidangd
rygdfsviamtdveagtqevigdyfgkegrfemrp

SCOPe Domain Coordinates for d1jdpb_:

Click to download the PDB-style file with coordinates for d1jdpb_.
(The format of our PDB-style files is described here.)

Timeline for d1jdpb_: