Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein Highdosage growth inhibitor YER057cp (YEO7_YEAST) [64319] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64320] (1 PDB entry) |
Domain d1jd1e_: 1jd1 E: [62894] |
PDB Entry: 1jd1 (more details), 1.7 Å
SCOPe Domain Sequences for d1jd1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jd1e_ d.79.1.1 (E:) Highdosage growth inhibitor YER057cp (YEO7_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ltpvicesapaaaasyshamkvnnliflsgqipvtpdnklvegsiadkaeqviqniknvl easnssldrvvkvnifladinhfaefnsvyakyfnthkparscvavaalplgvdmemeai aae
Timeline for d1jd1e_: