Lineage for d1jd1e_ (1jd1 E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958651Protein Highdosage growth inhibitor YER057cp (YEO7_YEAST) [64319] (1 species)
  7. 2958652Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64320] (1 PDB entry)
  8. 2958657Domain d1jd1e_: 1jd1 E: [62894]

Details for d1jd1e_

PDB Entry: 1jd1 (more details), 1.7 Å

PDB Description: crystal structure of yeo7_yeast
PDB Compounds: (E:) hypothetical 13.9 kda protein in fcy2-pet117 intergenic region

SCOPe Domain Sequences for d1jd1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd1e_ d.79.1.1 (E:) Highdosage growth inhibitor YER057cp (YEO7_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltpvicesapaaaasyshamkvnnliflsgqipvtpdnklvegsiadkaeqviqniknvl
easnssldrvvkvnifladinhfaefnsvyakyfnthkparscvavaalplgvdmemeai
aae

SCOPe Domain Coordinates for d1jd1e_:

Click to download the PDB-style file with coordinates for d1jd1e_.
(The format of our PDB-style files is described here.)

Timeline for d1jd1e_: