Lineage for d1jc7a_ (1jc7 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059339Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2059365Family b.40.3.2: The laminin-binding domain of agrin [63767] (1 protein)
    automatically mapped to Pfam PF03146
  6. 2059366Protein The laminin-binding domain of agrin [63768] (1 species)
  7. 2059367Species Chicken (Gallus gallus) [TaxId:9031] [63769] (4 PDB entries)
    Uniprot Q90685 # ! Fragment
  8. 2059371Domain d1jc7a_: 1jc7 A: [62873]
    complexed with cl

Details for d1jc7a_

PDB Entry: 1jc7 (more details), 2.73 Å

PDB Description: The Laminin-Binding Domain of Agrin is Structurally Related to N-TIMP-1
PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d1jc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc7a_ b.40.3.2 (A:) The laminin-binding domain of agrin {Chicken (Gallus gallus) [TaxId: 9031]}
cperelqrreeeanvvltgtveeimnvdpvhhtysckvrvwrylkgkdivtheilldggn
kvviggfgdplicdnqvstgdtriffvnpapqymwpahrnelmlnsslmritlrnleeve
hcveehrkl

SCOPe Domain Coordinates for d1jc7a_:

Click to download the PDB-style file with coordinates for d1jc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jc7a_: