Lineage for d1jc7a_ (1jc7 A:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.3: TIMP-like [50242] (2 families) 
Family b.40.3.2: The laminin-binding domain of agrin [63767] (1 protein) Protein The laminin-binding domain of agrin [63768] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [63769] (2 PDB entries) 
Domain d1jc7a_: 1jc7 A: [62873]
Details for d1jc7a_
PDB Entry: 1jc7 (more details), 2.73 Å
PDB Description: The Laminin-Binding Domain of Agrin is Structurally Related to N-TIMP-1
SCOP Domain Sequences for d1jc7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jc7a_ b.40.3.2 (A:) The laminin-binding domain of agrin {Chicken (Gallus gallus)}
cperelqrreeeanvvltgtveeimnvdpvhhtysckvrvwrylkgkdivtheilldggn
kvviggfgdplicdnqvstgdtriffvnpapqymwpahrnelmlnsslmritlrnleeve
hcveehrkl
SCOP Domain Coordinates for d1jc7a_:
Click to download the PDB-style file with coordinates for d1jc7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jc7a_:
- d1jc7a_ is new in SCOP 1.57
- d1jc7a_ appears in SCOP 1.59
- d1jc7a_ appears in the current release, SCOPe 2.08
View in 3D