Lineage for d1jc5f_ (1jc5 F:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255972Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 255973Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 256093Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
    Different assosiation of repeats but a similar dimeric structure to the glyoxalase dimer
  6. 256094Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 256095Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 256105Domain d1jc5f_: 1jc5 F: [62872]
    complexed with so4

Details for d1jc5f_

PDB Entry: 1jc5 (more details), 2.2 Å

PDB Description: Crystal Structure of Native Methylmalonyl-CoA Epimerase

SCOP Domain Sequences for d1jc5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc5f_ d.32.1.4 (F:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii}
edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq
vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg
gnrinfmhpksgkgvlieltqypk

SCOP Domain Coordinates for d1jc5f_:

Click to download the PDB-style file with coordinates for d1jc5f_.
(The format of our PDB-style files is described here.)

Timeline for d1jc5f_: