![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) ![]() |
![]() | Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein) Different association of repeats but a similar dimeric structure to the glyoxalase dimer |
![]() | Protein Methylmalonyl-CoA epimerase [64258] (1 species) |
![]() | Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries) |
![]() | Domain d1jc5e_: 1jc5 E: [62871] |
PDB Entry: 1jc5 (more details), 2.2 Å
SCOP Domain Sequences for d1jc5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jc5e_ d.32.1.4 (E:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} edlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmtq vqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgtg gnrinfmhpksgkgvlieltqypkn
Timeline for d1jc5e_: