Lineage for d1jc5c_ (1jc5 C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190970Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 190971Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 191069Family d.32.1.4: Methylmalonyl-CoA epimerase [64257] (1 protein)
  6. 191070Protein Methylmalonyl-CoA epimerase [64258] (1 species)
  7. 191071Species Propionibacterium shermanii [TaxId:1752] [64259] (2 PDB entries)
  8. 191078Domain d1jc5c_: 1jc5 C: [62869]

Details for d1jc5c_

PDB Entry: 1jc5 (more details), 2.2 Å

PDB Description: Crystal Structure of Native Methylmalonyl-CoA Epimerase

SCOP Domain Sequences for d1jc5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jc5c_ d.32.1.4 (C:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii}
nedlficidhvayacpdadeaskyyqetfgwhelhreenpeqgvveimmapaakltehmt
qvqvmaplndestvakwlakhngraglhhmawrvddidavsatlrergvqllydepklgt
ggnrinfmhpksgkgvlieltqypk

SCOP Domain Coordinates for d1jc5c_:

Click to download the PDB-style file with coordinates for d1jc5c_.
(The format of our PDB-style files is described here.)

Timeline for d1jc5c_: